DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a27

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:298 Identity:82/298 - (27%)
Similarity:138/298 - (46%) Gaps:33/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PLDLVKTRMQIS-----ATTGE-------YKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYTT 84
            ||||.|||:|:.     |..|:       |:......|.:.:.||.|.|:.|::..:.|...|:.
Mouse    52 PLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVYSG 116

  Fly    85 ARMGFYQ--MEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRM-MSDNRLPPAER 146
            .||..|:  .|:...:.:....|...:.:| |::||..|....||.::..::| |...|....:.
Mouse   117 GRMVTYEHLREVVFGKSEDKHYPLWKSVIG-GMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKP 180

  Fly   147 RNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF-------SGL 204
            ..:.||.:||.:|:.:.|:..||.|.:|.:.||.:|||..|.:|..:|    .|.       ..:
Mouse   181 LRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVK----HYLVLNTPLEDNI 241

  Fly   205 SLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE------YKGTMDVLMKVSKNEGIASLWKGF 263
            |.|..:::.|||:.:|...|.|:.|:||..|...:      ||.:.|.|::..:.||..||:|||
Mouse   242 STHGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSADCLIQAVQGEGFLSLYKGF 306

  Fly   264 TPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDSESNI 301
            .|...|:.......|:.|...:..:.::...|...|.:
Mouse   307 LPSWLRMVKMGEVLFLPLLLFSLYFSYLSFADSFHSEL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 80/282 (28%)
Mito_carr 19..90 CDD:278578 21/69 (30%)
Mito_carr 104..201 CDD:278578 29/97 (30%)
Mito_carr 207..284 CDD:278578 26/82 (32%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 23/78 (29%)
Mito_carr 138..232 CDD:365909 30/98 (31%)
Mito_carr 240..>314 CDD:365909 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.