DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and UCP2

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:252 Identity:79/252 - (31%)
Similarity:119/252 - (47%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTV 107
            :..:.:|:.....:|.:.:.||..:|||||.|||.||.::.:.|:|.|...     |||....:.
Human    54 ATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSV-----KQFYTKGSE 113

  Fly   108 LASMGMGILA----GAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITL 168
            .||:|..:||    ||.......|.:|..:|..:..|  ....|.|...:||:..|.::||...|
Human   114 HASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR--AGGGRRYQSTVNAYKTIAREEGFRGL 176

  Fly   169 WKGCMPTVGRAMIVNMVQLASYSQLKAAFSE---YFSGLSLHIAAAMMSGLLTTIASMPLDMAKT 230
            |||..|.|.|..|||..:|.:|..:|.|..:   ....|..|..:|..:|..||:.:.|:|:.||
Human   177 WKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT 241

  Fly   231 RIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKA 287
            |.......:|.......:.:.:.||..:.:|||.|...|||...|..|:..|||.:|
Human   242 RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 78/250 (31%)
Mito_carr 19..90 CDD:278578 16/46 (35%)
Mito_carr 104..201 CDD:278578 32/103 (31%)
Mito_carr 207..284 CDD:278578 23/76 (30%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 20/62 (32%)
Mito_carr 113..207 CDD:278578 32/95 (34%)
Mito_carr 218..300 CDD:278578 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.