DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a30

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:262 Identity:86/262 - (32%)
Similarity:136/262 - (51%) Gaps:31/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISATTGE-------YKSSFDCLLKVFKNEGILALYNGLS 73
            ::.||||.:...|...|:||.|||:||...|.:       |:.....|:::.:.||:.|||:|::
Mouse     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIA 73

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAP--PTVLASMGMGILAGAFGAMFGNPAEVALIRMM 136
            ..::|||:|.|.::|.||   ...|.....|  .|:|.::..|||:|...:...||.:|..|||.
Mouse    74 PAMLRQASYGTIKIGTYQ---SLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQ 135

  Fly   137 SDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF 201
            :.|.....      |::::|:.|.:.||...||||...|..||.||..|:|..|...|...  ..
Mouse   136 AQNSAVQG------GMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHL--IL 192

  Fly   202 SGL-----SLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT------AEYKGTMDVLMKVSKNEG 255
            |||     :.|..::...||:..:||.|:|:.:||:..|:.      |.||||:|.|::||.:.|
Mouse   193 SGLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQVSVSAG 257

  Fly   256 IA 257
            ::
Mouse   258 LS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 86/262 (33%)
Mito_carr 19..90 CDD:278578 28/77 (36%)
Mito_carr 104..201 CDD:278578 32/98 (33%)
Mito_carr 207..284 CDD:278578 20/57 (35%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 30/89 (34%)
Mito_carr 105..191 CDD:365909 31/93 (33%)
Mito_carr 199..>259 CDD:365909 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.