DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a11

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001025683.1 Gene:slc25a11 / 595075 XenbaseID:XB-GENE-979673 Length:305 Species:Xenopus tropicalis


Alignment Length:303 Identity:159/303 - (52%)
Similarity:204/303 - (67%) Gaps:10/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYSIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGEYKSSFDCLLKVFKN 62
            ||.:..:::.|..:.::.||||||..|..||||||||.|||:|   |.|.|||:||..:..:.:|
 Frog     1 MAEAGRQRTSPKAVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRN 65

  Fly    63 EGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNP 127
            ||:..:|.||||||:|||||||.|:|.|.:..:.:.|....||..|....:|:.|||.||..|.|
 Frog    66 EGLRGIYTGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTP 130

  Fly   128 AEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQ 192
            ||||||||.:|.|:|..:||.||.|.||.||:.::||:.|||:||:||:.||::||..|||||||
 Frog   131 AEVALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQ 195

  Fly   193 LKAAFSE--YF-SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQK----TAEYKGTMDVLMKV 250
            .|....:  || ..:..|..|:|:|||:||.||||:|:||||||..:    ..|||..:|||:||
 Frog   196 SKQFLLDTGYFGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKV 260

  Fly   251 SKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVL 293
            .:.||..|||||||||..|||||||..||||||:.|.||...|
 Frog   261 VRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYKKFFL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 152/280 (54%)
Mito_carr 19..90 CDD:278578 45/73 (62%)
Mito_carr 104..201 CDD:278578 52/98 (53%)
Mito_carr 207..284 CDD:278578 50/80 (63%)
slc25a11NP_001025683.1 PTZ00169 13..296 CDD:240302 152/282 (54%)
Mito_carr 13..93 CDD:278578 45/79 (57%)
Mito_carr 107..202 CDD:278578 52/94 (55%)
Mito_carr 210..302 CDD:278578 54/91 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.