DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a10

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:274 Identity:98/274 - (35%)
Similarity:140/274 - (51%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82
            ||||.....|...||||:|..:|   |..|.|.....: :.|.:|:|.|||||||||.|.||.||
 Frog    12 GGLASCGAACCTHPLDLIKVHLQ---TQQEVKMRMTGMAISVIRNDGFLALYNGLSASLFRQITY 73

  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147
            :..|...|:...|...:...||......:.:|.:.|..|...|.||::..:||.:|.:||...||
 Frog    74 SLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKLPAHLRR 138

  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF--SEYFS-GLSLHIA 209
            ||...|:...|::::||...|:.|......|..:|.:.|||.|.|.|...  :.:.| .:..|..
 Frog   139 NYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDNIFTHFL 203

  Fly   210 AAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHT 274
            |:.::|...|....|||:.|||:...| .||:|.:...::.:| .|..:.:||..|...||.|||
 Frog   204 ASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAK-LGPLAFYKGLVPAGIRLIPHT 266

  Fly   275 VFAFIFLEQLTKAY 288
            |..|:|||||.|.:
 Frog   267 VLTFVFLEQLRKYF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 97/271 (36%)
Mito_carr 19..90 CDD:278578 32/71 (45%)
Mito_carr 104..201 CDD:278578 30/98 (31%)
Mito_carr 207..284 CDD:278578 29/76 (38%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 34/79 (43%)
Mito_carr 96..190 CDD:365909 29/93 (31%)
Mito_carr 197..281 CDD:365909 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.