DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a35

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001102503.1 Gene:Slc25a35 / 497933 RGDID:1598229 Length:300 Species:Rattus norvegicus


Alignment Length:299 Identity:88/299 - (29%)
Similarity:144/299 - (48%) Gaps:28/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MMYINGGLAGMLGTCI-VQPLDLVKTRMQISATTGE----------YKSSFDCLLKVFKNEGILA 67
            |.::..|:|. .|.|: ..||::||||||:.   ||          |::.|.....:.|.:|:.|
  Rat     1 MDFLMSGVAA-CGACVFTNPLEVVKTRMQLQ---GELQAPGTYQRHYRNVFHAFFTIGKVDGLAA 61

  Fly    68 LYNGLSAGLMRQATYTTARMGFYQM-EIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVA 131
            |..||...|:.|......|:|.|.: |...|.:......:.:.|...|.|||..||..|:|..:.
  Rat    62 LQKGLGPALLYQFLMNGIRLGTYGLAESGGYLRTKEGTHSPVRSAAAGALAGVMGAYLGSPIYMV 126

  Fly   132 LIRMMSD--NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLK 194
            ...:.:.  :.:....:..:.|:..|...|.:..|::.||:|.:..:.|.:|.:..||.::|..|
  Rat   127 KTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPRVVIGSSTQLCTFSSTK 191

  Fly   195 AAFS--EYFSGLS--LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT------AEYKGTMDVLMK 249
            ...|  |.|...|  :.:||||:||:...:|..|.|:|.||:..|.|      ..|:|.:|.|::
  Rat   192 DLLSQWEIFPPQSWKVALAAAMVSGVAVVLAMTPFDVASTRLYNQPTDTRGKGLMYRGILDALLQ 256

  Fly   250 VSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288
            .::.||:..::||......||||||:.:..|.:||...|
  Rat   257 TARTEGLFGMYKGIGASYFRLGPHTILSLFFWDQLRSFY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 86/294 (29%)
Mito_carr 19..90 CDD:278578 26/81 (32%)
Mito_carr 104..201 CDD:278578 24/100 (24%)
Mito_carr 207..284 CDD:278578 29/82 (35%)
Slc25a35NP_001102503.1 Mito_carr 2..84 CDD:395101 26/85 (31%)
Mito_carr 98..195 CDD:395101 22/96 (23%)
Mito_carr 209..298 CDD:395101 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.