DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and mfrn

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:307 Identity:70/307 - (22%)
Similarity:125/307 - (40%) Gaps:41/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSIPGYMMYIN---GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALY 69
            :|:|...:.:|   |.:||:|...::.|||.||||||..:...:..:....|..:...||:|...
  Fly     7 ESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRTMITREGLLRPI 71

  Fly    70 NGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAM----FGNPAEV 130
            .|.||.::......:.....|:|     .|:..|..|.:.::.. :::||...:    ..:|.:|
  Fly    72 RGASAVVLGAGPAHSLYFAAYEM-----TKELTAKFTSVRNLNY-VISGAVATLIHDAISSPTDV 130

  Fly   131 ALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKA 195
            ...||...|       ..||.|::....|.|.||    :|......|..:::|:    .|..:..
  Fly   131 IKQRMQMYN-------SPYTSVVSCVRDIYKREG----FKAFYRAYGTQLVMNL----PYQTIHF 180

  Fly   196 AFSEYFSGL---------SLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVS 251
            ...|:|...         .:|:||...:|......:.|||:.||.:..|:|...:|.::...|:.
  Fly   181 TTYEFFQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEASRKIY 245

  Fly   252 KNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDSE 298
            ...|....::|.|..:....|.|...:...|    .:|..:.|.|::
  Fly   246 HMAGPLGFFRGTTARVLYSMPATAICWSTYE----FFKFYLCGLDAD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 65/286 (23%)
Mito_carr 19..90 CDD:278578 20/70 (29%)
Mito_carr 104..201 CDD:278578 20/100 (20%)
Mito_carr 207..284 CDD:278578 19/76 (25%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 24/89 (27%)
PTZ00168 17..280 CDD:185494 65/287 (23%)
Mito_carr 107..190 CDD:278578 20/98 (20%)
Mito_carr <215..282 CDD:278578 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.