DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and DPCoAC

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:125/292 - (42%) Gaps:35/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQI-SATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQA 80
            |:|..||.|...::.|||..|...|| :.....:::|...|...:.|||:|||:.|.||.:.|..
  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIV 141

  Fly    81 TYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGN----PAEVALIRMMSDNRL 141
            .|...:...::.    :|:..:.......:.|...|||:...:...    |.::|..||...:| 
  Fly   142 PYAAIQFTAHEQ----WRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDR- 201

  Fly   142 PPAERRNYTG---VLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFSG 203
                   |||   :...|.:|..:||..||::|...||...:........:|..||..:.|....
  Fly   202 -------YTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGN 259

  Fly   204 ------LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQK--TA---EYKGTMDVLMKVSKNEGIA 257
                  :||...||  :|.....||.|||:.:.|:|..:  ||   .|...::.|:|:.:.||:.
  Fly   260 NKPNTLVSLAFGAA--AGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVK 322

  Fly   258 S-LWKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288
            : .:||.:....: ||..|........|.||:
  Fly   323 NGFYKGLSMNWIK-GPIAVGISFSTYDLIKAW 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 75/289 (26%)
Mito_carr 19..90 CDD:278578 23/71 (32%)
Mito_carr 104..201 CDD:278578 25/103 (24%)
Mito_carr 207..284 CDD:278578 22/82 (27%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 25/85 (29%)
Mito_carr 169..251 CDD:278578 23/89 (26%)
Mito_carr 279..356 CDD:278578 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.