DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Dic1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:286 Identity:103/286 - (36%)
Similarity:153/286 - (53%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYN 70
            |:||     |:..||||.:....:..||||:|..:|   |...:.|....:.|:.:.:|:|..||
  Fly     5 ERKS-----MWFFGGLASVGAAMVTHPLDLIKVTLQ---TQQGHLSVAQLIPKLAREQGVLVFYN 61

  Fly    71 GLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGI-LAGA---FGAMFGNPAEVA 131
            ||||.::||.||:|||.|.|    :|.:|..|..     |.|..: ||||   .|.:.|.||::.
  Fly    62 GLSASVLRQLTYSTARFGVY----EAGKKYVNTD-----SFGGKVALAGASGLVGGIVGTPADMV 117

  Fly   132 LIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAA 196
            .:||.:|.:|||.:||||....:..||:.:.||...|:.|......|.:::.:.|:|.|.|.|..
  Fly   118 NVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY 182

  Fly   197 F--SEYF-SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIAS 258
            .  :.|| ..|..|..|::::|.:.|..:.|||:.|||....|..|:.|..|::...:| .|...
  Fly   183 LLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAK-LGPLG 246

  Fly   259 LWKGFTPYLCRLGPHTVFAFIFLEQL 284
            .:||:.|...||||||:..|:|||||
  Fly   247 FFKGYVPAFVRLGPHTIITFVFLEQL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 99/276 (36%)
Mito_carr 19..90 CDD:278578 29/70 (41%)
Mito_carr 104..201 CDD:278578 32/102 (31%)
Mito_carr 207..284 CDD:278578 29/76 (38%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 33/93 (35%)
PTZ00169 13..273 CDD:240302 99/273 (36%)
Mito_carr 89..184 CDD:278578 33/99 (33%)
Mito_carr 189..278 CDD:278578 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441893
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.