DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a11

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:298 Identity:160/298 - (53%)
Similarity:200/298 - (67%) Gaps:10/298 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AYSIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGEYKSSFDCLLKVFKNE 63
            |.:.:.|:.|..:.::.||||||..|..||||||||.|||:|   :...|||:||..:..:.:||
Zfish     5 ADTAKPKTSPKSIKFLFGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSFHAVGSILRNE 69

  Fly    64 GILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPA 128
            |:..:|.||||||:|||||||.|:|.|.:..:...|....||.......:|:.|||.||..|.||
Zfish    70 GVRGIYTGLSAGLLRQATYTTTRLGIYTILFERMSKADGTPPNFFMKALIGMTAGATGAFVGTPA 134

  Fly   129 EVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQL 193
            |||||||.:|.||||.:||.||.|.||.|||.::|||.|||:||:||:.||::||..|||||||.
Zfish   135 EVALIRMTADGRLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQLASYSQS 199

  Fly   194 KAAF--SEYF-SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQK----TAEYKGTMDVLMKVS 251
            |.|.  |.|| ..:..|..|:|:|||:||.||||:|:.|||||..:    ..||...:|||:||.
Zfish   200 KQALLDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYNNGLDVLVKVI 264

  Fly   252 KNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYK 289
            :|||..|||||||||..|||||||..||||||:.|.||
Zfish   265 RNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKFYK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 154/280 (55%)
Mito_carr 19..90 CDD:278578 43/73 (59%)
Mito_carr 104..201 CDD:278578 57/98 (58%)
Mito_carr 207..284 CDD:278578 49/80 (61%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 43/77 (56%)
PTZ00169 19..300 CDD:240302 154/280 (55%)
Mito_carr 110..207 CDD:278578 56/96 (58%)
Mito_carr 213..305 CDD:278578 53/90 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.