DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and GC2

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:284 Identity:84/284 - (29%)
Similarity:131/284 - (46%) Gaps:50/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQISATTGE-----YKSSFDCLLKVFKNEGILALYNGLSAGL 76
            ||||:||::|...|.|||:||||:| :.|.|.     |.|..||..|...:||...:|.|.:..:
  Fly    25 INGGVAGIIGVACVYPLDMVKTRLQ-NQTIGPNGERMYTSIADCFRKTIASEGYFGMYRGSAVNI 88

  Fly    77 M----RQATYTTARMGF-YQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMM 136
            :    .:|...||...| |.:..|.     ...|...|::..| |||.|..:...|.|:..|:|.
  Fly    89 VLITPEKAIKLTANDFFRYHLASDD-----GVIPLSRATLAGG-LAGLFQIVVTTPMELLKIQMQ 147

  Fly   137 SDNRLPPAER------RNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKA 195
            ...|:..|:|      :..| .|.....::::.|:..|:||...|..|.:..:||    |..|.|
  Fly   148 DAGRVAAADRAAGREVKTIT-ALGLTKTLLRERGIFGLYKGVGATGVRDITFSMV----YFPLMA 207

  Fly   196 AFSE--------------YFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDV 246
            ..::              |:|     :.|.::||:.:.....|.|:.|||:|.....::||.||.
  Fly   208 WINDQGPRKSDGSGEAVFYWS-----LIAGLLSGMTSAFMVTPFDVVKTRLQADGEKKFKGIMDC 267

  Fly   247 LMKVSKNEGIASLWKGFTPYLCRL 270
            :.:..|.|||::.:||   .|||:
  Fly   268 VNRTLKEEGISAFFKG---GLCRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 84/284 (30%)
Mito_carr 19..90 CDD:278578 29/80 (36%)
Mito_carr 104..201 CDD:278578 27/116 (23%)
Mito_carr 207..284 CDD:278578 22/64 (34%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 84/284 (30%)
Mito_carr 16..106 CDD:278578 30/81 (37%)
Mito_carr 123..203 CDD:278578 22/85 (26%)
Mito_carr 228..302 CDD:278578 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.