DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Dic4

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:288 Identity:84/288 - (29%)
Similarity:141/288 - (48%) Gaps:24/288 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYT 83
            ||.|.|.....|.|:|:|||.|||..   :.:|....:.::...:|.|..|:|.||.::||.|.|
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQR---QKRSILGTVKRIHSLKGYLGFYDGFSAAILRQMTST 87

  Fly    84 TARMGFY----QMEI---DAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRL 141
            ......|    :||.   |:|          |..:.:|.:|||.|:.||.|.::..:||.:|.:.
  Fly    88 NIHFIVYDTGKKMEYVDRDSY----------LGKIILGCVAGACGSAFGIPTDLINVRMQTDMKE 142

  Fly   142 PPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFS---G 203
            ||.:||||..|.:..:||.|:||...|:||....|.::.:....|:|.|..:|....:..|   |
  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207

  Fly   204 LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLC 268
            |.||...::.:.::::..:.|||:.:|.:...:..|::......:.:.: .|:...::||.|.:.
  Fly   208 LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMR-FGVMGPYRGFVPTIV 271

  Fly   269 RLGPHTVFAFIFLEQLTKAYKHIVLGDD 296
            |..|.|...|:..|||...:....||.:
  Fly   272 RKAPATTLLFVLYEQLRLHFGICSLGGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 82/277 (30%)
Mito_carr 19..90 CDD:278578 24/70 (34%)
Mito_carr 104..201 CDD:278578 32/96 (33%)
Mito_carr 207..284 CDD:278578 15/76 (20%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 81/275 (29%)
Mito_carr 26..100 CDD:278578 25/76 (33%)
Mito_carr 104..201 CDD:278578 34/106 (32%)
Mito_carr 211..292 CDD:278578 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.