DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a10b

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_957466.1 Gene:slc25a10b / 394147 ZFINID:ZDB-GENE-040426-1095 Length:286 Species:Danio rerio


Alignment Length:291 Identity:99/291 - (34%)
Similarity:139/291 - (47%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGEYK-SSFDCLLKVFKNEGILALY 69
            ||:....|.    ||:|.....|...||||:|..:|   |..|.| ......:.|.||:|.||||
Zfish     3 EKRMSRWYF----GGIASCGAACCTHPLDLIKVHLQ---TQQEVKMRMMGMAIHVVKNDGFLALY 60

  Fly    70 NGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIR 134
            :||||.|.||.:|:..|...|:...|........|......:.:|...|..|...|.||::..:|
Zfish    61 SGLSASLCRQMSYSLTRFAIYETVRDTLGSGSQGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVR 125

  Fly   135 MMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSE 199
            |.:|.:||..:||||...|:...|:.::||...|:.|......|..:|.:.|||.|.|.|    :
Zfish   126 MQNDVKLPLEQRRNYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAK----Q 186

  Fly   200 YFSGLSL-------HIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIA 257
            ...|..|       |..::.::|...|....|||:.|||:...| .||:|.|..|.:.:| .|..
Zfish   187 LVLGTGLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYRGVMHCLSETAK-LGPL 249

  Fly   258 SLWKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288
            :.:||..|...||.|||:..|:|||||.|.:
Zfish   250 AFYKGLVPAGIRLIPHTILTFVFLEQLKKYF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 95/278 (34%)
Mito_carr 19..90 CDD:278578 30/71 (42%)
Mito_carr 104..201 CDD:278578 30/96 (31%)
Mito_carr 207..284 CDD:278578 29/76 (38%)
slc25a10bNP_957466.1 PTZ00169 12..278 CDD:240302 95/274 (35%)
Mito_carr 12..92 CDD:278578 32/82 (39%)
Mito_carr <118..190 CDD:278578 25/75 (33%)
Mito_carr 197..281 CDD:278578 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.