DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a27

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:322 Identity:91/322 - (28%)
Similarity:142/322 - (44%) Gaps:48/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYSIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQI-----------SATTGEYKSSFD 54
            |::..|....|....:.....|..:...:..||||.|||:||           |..|.:|:....
Zfish     1 MSHLQENSRWPRVSKFTLSACAAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLS 65

  Fly    55 CLLKVFKNEGILALYNGLSAGLMRQATYTTARM-GFYQMEIDAYRKQ----FNAPPTVLASMGMG 114
            ....:.:.||.|.|:.|::..:.|...|:..|| .:.||......|.    |.....|:|||   
Zfish    66 TAAGIVREEGPLKLWQGVTPAIYRHIVYSGGRMLAYEQMRESVLGKSEDGIFPVWKAVIASM--- 127

  Fly   115 ILAGAFGAMFGNPAEVALIRMMSDNR-----LPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMP 174
             ::||.|....:|.::..::|..:.|     .||..|    ||.:||.:||...|:..||.|.:|
Zfish   128 -ISGALGQFIASPTDLVKVQMQMEGRRRLEGKPPRVR----GVYHAFTKIVAQGGIRGLWAGWVP 187

  Fly   175 TVGRAMIVNMVQLASYSQLKAAFSEYFS--------GLSLHIAAAMMSGLLTTIASMPLDMAKTR 231
            .|.||.:||:..|.:|..:|.......|        |||     ::.|||:......|.|:.|||
Zfish   188 NVQRAALVNLGDLMTYDTVKHFLLRNTSIPDNSICHGLS-----SICSGLVAATMGTPADVVKTR 247

  Fly   232 IQQQ------KTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKA 287
            :..|      :...|:.:.|.|::..:.||..||:|||.|...|:.|.::..::..|||.:|
Zfish   248 VMNQPRDSNGRGLLYRNSTDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRRA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 87/305 (29%)
Mito_carr 19..90 CDD:278578 22/82 (27%)
Mito_carr 104..201 CDD:278578 32/101 (32%)
Mito_carr 207..284 CDD:278578 23/82 (28%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 24/98 (24%)
PTZ00169 16..310 CDD:240302 88/307 (29%)
Mito_carr 118..213 CDD:278578 32/102 (31%)
Mito_carr 217..311 CDD:278578 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.