DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a14

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:287 Identity:97/287 - (33%)
Similarity:152/287 - (52%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISATTG----EYKSSFDCLLKVFKNEGILALYNGLSAGL 76
            ::.||:|.::......|:||.|||:|:...|.    .|:..|..||::.:.||:.|||:|:|..|
Zfish    58 FVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPAL 122

  Fly    77 MRQATYTTARMGFYQMEIDAYRKQFNAPP---TVLASMGMGILAGAFGAMFGNPAEVALIRMMSD 138
            :|||:|.|.::|.|    :..:|.|.:.|   |::.::..|:::|...:...||.:|..|||.:.
Zfish   123 LRQASYGTIKIGTY----NTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQ 183

  Fly   139 NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFSG 203
            ..|...      .:::.|:.|.:.||...||:|.:||..||.||..|:|..|...|.....  ||
Zfish   184 GSLLQG------SMMSNFMNIYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIR--SG 240

  Fly   204 LS-----LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE----YKGTMDVLMKVSKNEGIASL 259
            |.     .|..::...||...:||.|:|:.:||:..|:...    ||||:|.||:..:|||..:|
Zfish   241 LMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFAL 305

  Fly   260 WKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            :|||.|...||||..:..|:..|||.|
Zfish   306 YKGFWPNWLRLGPWNIIFFMTFEQLKK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 97/287 (34%)
Mito_carr 19..90 CDD:278578 29/74 (39%)
Mito_carr 104..201 CDD:278578 28/99 (28%)
Mito_carr 207..284 CDD:278578 31/80 (39%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.