DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and PMP34

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:308 Identity:67/308 - (21%)
Similarity:134/308 - (43%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YMMYINGGLAGMLGTCIVQ----PLDLVKTRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLS 73
            |..::: .::|..|.||..    |||.|::|:|:. ..|:.:|:...:.::...||..:||.|| 
  Fly    13 YQNFVH-AVSGAAGGCIAMSTFYPLDTVRSRLQLE-EAGDVRSTRQVIKEIVLGEGFQSLYRGL- 74

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPP--TVLASMGMGILAGAFGAMFGNPAEVALIRMM 136
             |.:.|:...:..:.||............:|.  :.|..:.:|.:||....:...|..|...|:.
  Fly    75 -GPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLR 138

  Fly   137 SDNRLPPAE--RRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVN--MVQLASYSQLKAAF 197
            ..|....::  .::|..:|.....:.:.||:..||.|.:|::   |:|:  .:|...|..||...
  Fly   139 MRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSL---MLVSNPALQFMMYEMLKRNI 200

  Fly   198 SEYFSG----LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQ-------------KTAEYKGTMD 245
            ..:..|    ||.....|:... ..|:.:.||.:.:|:.:.:             .|...:.|::
  Fly   201 MRFTGGEMGSLSFFFIGAIAKA-FATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLE 264

  Fly   246 VLMKVSKNEGIASLWKGFTPYLCRLGPHTVF--AFIFLEQLTKAYKHI 291
            :::.:.:::||..|::|....:.:    ||.  |.:|:     ||:.|
  Fly   265 LMISILQHQGIRGLFRGLEAKILQ----TVLTAALMFM-----AYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 63/299 (21%)
Mito_carr 19..90 CDD:278578 20/74 (27%)
Mito_carr 104..201 CDD:278578 23/102 (23%)
Mito_carr 207..284 CDD:278578 15/91 (16%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 22/84 (26%)
Mito_carr 105..202 CDD:278578 22/99 (22%)
Mito_carr 214..303 CDD:278578 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.