DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a34

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_006539059.1 Gene:Slc25a34 / 384071 MGIID:2686215 Length:333 Species:Mus musculus


Alignment Length:305 Identity:86/305 - (28%)
Similarity:134/305 - (43%) Gaps:45/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGE----------YKSSFDCLLKVFKNEGILALYNGLS 73
            |..|..|......||::||||:|:.   ||          |:.....:..|.:.:|:..|..||:
Mouse    27 GASACCLACVFTNPLEVVKTRLQLQ---GELQAPGTYPRPYRGFVSSVAAVARADGLWGLQKGLA 88

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEV---ALIRM 135
            |||:.|......|...|.:...|...| ....||:|    |..|||.||..|:||.:   :::.:
Mouse    89 AGLLYQGLMNGVRFYCYSLACQAGLTQ-QPGGTVVA----GAAAGALGAFVGSPAYLFPGSILEL 148

  Fly   136 MSDNRL--------------PPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQ 186
            .|...|              ....:..:.|||:|...|.:.:|::.||:|....|.|..:.:..|
Mouse   149 PSALNLQVKTQLQAQTVATMAVGHQHQHQGVLSALETIWRQQGMLGLWRGVGGAVPRVTVGSAAQ 213

  Fly   187 LASYSQLKAAFS--EYF--SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE------YK 241
            ||:::..||...  ::|  ....:.:|..|:|.:.......|||:..||:..|....      |.
Mouse   214 LATFTSAKAWVQDRQWFLEDSWLVTLAGGMISSIAVVAVMTPLDVVSTRLYNQPVDRAGRGQLYG 278

  Fly   242 GTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            |..|.|:|..:.||..:|:||..|...||||||:.:..|.::|.|
Mouse   279 GLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSMFFWDELRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 86/305 (28%)
Mito_carr 19..90 CDD:278578 23/80 (29%)
Mito_carr 104..201 CDD:278578 30/115 (26%)
Mito_carr 207..284 CDD:278578 27/82 (33%)
Slc25a34XP_006539059.1 Mito_carr 18..105 CDD:365909 23/80 (29%)
Mito_carr <156..226 CDD:365909 16/69 (23%)
Mito_carr 234..324 CDD:365909 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.