DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Tpc2

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:333 Identity:80/333 - (24%)
Similarity:138/333 - (41%) Gaps:57/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTR--MQISATTGEYKSSFDCLLKVFKN----EG 64
            |...:...|..:.||:||.....|.||||::|.|  ||:...|....|.:..::..||:    ||
  Fly     3 ENSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEG 67

  Fly    65 ILALYNGLSAGLMRQATYTTARMGFYQM------EIDAYRKQFNAPPTVLASMGMGILAGAFGAM 123
            :..::.|.::|.:...:|...:...|:.      :.|.:|::    |.::..:..|| ||..||:
  Fly    68 MRGMFRGHNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRER----PFLMFFICGGI-AGCLGAV 127

  Fly   124 FGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQL- 187
            ...|.:|...:|::.:   |:.||:.........::.|.||    |.|    :.|.:...:||: 
  Fly   128 AAQPFDVVRTQMVAAD---PSSRRSQMNTFTGLRKVYKMEG----WMG----LSRGLPFTLVQVF 181

  Fly   188 -------ASYSQLKAAF--------SEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRI----- 232
                   ..|..|.||.        .:...|..|.:..| :||:|..:...|.|:.|.||     
  Fly   182 PLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFLFLNGA-LSGVLAKMIVYPADLLKKRIQLMAF 245

  Fly   233 -QQQKT----AEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIV 292
             |::||    .|....:..:....:.|||...:||..|.|.:.|..:...|...:...:.|  |.
  Fly   246 KQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY--IA 308

  Fly   293 LGDDSESN 300
            ...::|.|
  Fly   309 PMKEAEKN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 74/308 (24%)
Mito_carr 19..90 CDD:278578 22/76 (29%)
Mito_carr 104..201 CDD:278578 25/112 (22%)
Mito_carr 207..284 CDD:278578 22/86 (26%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 70/297 (24%)
Mito_carr 23..99 CDD:278578 19/75 (25%)
Mito_carr 108..194 CDD:278578 22/101 (22%)
Mito_carr 216..307 CDD:278578 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.