DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and sea

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:294 Identity:75/294 - (25%)
Similarity:130/294 - (44%) Gaps:37/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 INGGLAGMLGTCIVQPLDLVKTRMQI--SATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQ 79
            :.||:.|.:..||..|.:.|||::|:  .....:|...|||:.|.....|.|.||.|||..:...
  Fly    38 VAGGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGS 102

  Fly    80 ATYTTARMGFYQM----EIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNR 140
            ...:.||.|.::.    .:|: |.|.:....:|..:|.|:.......   .|.|...::.::|.|
  Fly   103 IPKSAARFGAFEFLKSNAVDS-RGQLSNSGKLLCGLGAGVCEAIVAV---TPMETIKVKFINDQR 163

  Fly   141 LPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTV---GRAMIVNMVQLASYSQLKAAFSEYFS 202
               :....:.|..:...:|:|.||:..::||..||:   |....:....|.|...|       :.
  Fly   164 ---SGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDL-------YK 218

  Fly   203 G---------LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIAS 258
            |         |.:.:..| ::|..:...:.|||:.|||:|..:.::||.|....:::.||||.|:
  Fly   219 GDDHTKPVPKLVVGVFGA-IAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAVEILKNEGPAA 282

  Fly   259 LWKGFTPYLCRLGPHTVFAFI----FLEQLTKAY 288
            .:||..|.|.|:.......|:    |::...|.:
  Fly   283 FYKGTVPRLGRVCLDVAITFMIYDSFMDLFNKVW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 74/291 (25%)
Mito_carr 19..90 CDD:278578 25/72 (35%)
Mito_carr 104..201 CDD:278578 20/99 (20%)
Mito_carr 207..284 CDD:278578 24/80 (30%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 72/278 (26%)
Mito_carr 34..117 CDD:278578 25/78 (32%)
Mito_carr 125..220 CDD:278578 21/107 (20%)
Mito_carr 235..314 CDD:278578 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.