DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and CG18324

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:291 Identity:82/291 - (28%)
Similarity:137/291 - (47%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGEYKSSF----DCLLKVFKNEGILALYNGLS 73
            ::.||.|.|.......|:|:||||||:.   |..|.|...:    ..:|::..|:|:|||..||:
  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLA 70

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGM--GILAGAFGAMFGNPAEV--ALIR 134
            ..|..|....:.|:..|...::....| ||..::....||  |.|.|..|..|.:|..:  |...
  Fly    71 PALCYQFVLNSVRLSVYSNALELGYLQ-NADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQH 134

  Fly   135 MMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSE 199
            ..:...:....:..:|.:::|.:.|.:..|:...|:..:|::.|.::.:.||:.::.:.|:...:
  Fly   135 AQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKD 199

  Fly   200 YFSGLSLH-----IAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE------YKGTMDVLMKVSKN 253
              .|...|     ..|.:.||.|..:|:.|.|:..||:..|...|      |||.:|...|:.:.
  Fly   200 --KGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262

  Fly   254 EGIASLWKGFTPYLCRLGPHTVFAFIFLEQL 284
            |||..::|||.|...|..|||...|:|.|:|
  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 82/291 (28%)
Mito_carr 19..90 CDD:278578 26/77 (34%)
Mito_carr 104..201 CDD:278578 19/100 (19%)
Mito_carr 207..284 CDD:278578 31/87 (36%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 26/80 (33%)
PTZ00169 5..293 CDD:240302 81/289 (28%)
Mito_carr 101..201 CDD:278578 19/101 (19%)
Mito_carr 204..296 CDD:278578 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.