DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and CG8026

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:298 Identity:76/298 - (25%)
Similarity:133/298 - (44%) Gaps:30/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YMMYINGGLAGMLGTCIVQPLDLVKTRMQI----SATTGEYKSSFDCLLKVFKNEGILALYNGLS 73
            |...:.|...|::.|.|:.||||:|.|..:    :||..:|:........:|:.||...||.|::
  Fly    23 YEHLVAGVSGGVVSTLILHPLDLIKIRFAVNDGRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVT 87

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAP----PT--VLASMGMGILAGAFGAMFGNPAEVAL 132
            ..:....:.......||. .|..:.:..|..    ||  :||:...|||.    .:..||..|..
  Fly    88 PNVWGSGSSWGLYFMFYN-TIKTFIQGGNTTMPLGPTMNMLAAAESGILT----LLLTNPIWVVK 147

  Fly   133 IRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF 197
            .|:..  :...|....|.|:::|..:|.|:||:..|::|.:|.: ..:....:|..:|.:||.|:
  Fly   148 TRLCL--QCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGM-LGVSHGAIQFMTYEELKNAY 209

  Fly   198 SEYFS-------GLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEG 255
            :||..       ..:.::|.|.:|.|:...|:.|..:.:.|:|... ..|.||.|.:.:..:.||
  Fly   210 NEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHH-HRYNGTWDCIKQTWRFEG 273

  Fly   256 IASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVL 293
            ....:||....|.|:.|..:..|:..|.::    |.:|
  Fly   274 YRGFYKGLKASLTRVVPACMVTFLVYENVS----HFLL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 73/287 (25%)
Mito_carr 19..90 CDD:278578 19/74 (26%)
Mito_carr 104..201 CDD:278578 28/102 (27%)
Mito_carr 207..284 CDD:278578 21/76 (28%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 70/272 (26%)
Mito_carr 23..115 CDD:278578 23/92 (25%)
Mito_carr 119..213 CDD:278578 28/100 (28%)
Mito_carr 220..307 CDD:278578 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.