DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and CG4995

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:284 Identity:67/284 - (23%)
Similarity:115/284 - (40%) Gaps:46/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQI-SATTGEYKSSFDCLLKVFKNEGILALYNGLSA----- 74
            ::.|.|.|..|..:..|.|.||..:|. .....:||.:|.|...:.:.:..:.||.|:|:     
  Fly    44 FVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGI 108

  Fly    75 GLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDN 139
            ||:....:     |.|    ...::..|.|.::.:....|.:||........|.|:|..|:....
  Fly   109 GLVNAIVF-----GVY----GNVQRLSNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLST 164

  Fly   140 RLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF--- 201
            ::....:  :||.::....|||.||:...:||...|:.|.:              ..|:.||   
  Fly   165 QVDSGIK--FTGPIHCLKYIVKTEGIRGAFKGLTATILRDI--------------PGFASYFVSF 213

  Fly   202 ---------SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQ---KTAEYKGTMDVLMKVSKNE 254
                     .|::..:.|...:|:.:.:|..|:|:.||.:|..   ..|:|.|.:|..||..:||
  Fly   214 EYLMRQVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNE 278

  Fly   255 GIASLWKGFTPYLCRLGPHTVFAF 278
            |....::|....|.|..|.....|
  Fly   279 GPQYFFRGLNSTLIRAFPMNAACF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 67/284 (24%)
Mito_carr 19..90 CDD:278578 20/76 (26%)
Mito_carr 104..201 CDD:278578 20/96 (21%)
Mito_carr 207..284 CDD:278578 22/75 (29%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 21/89 (24%)
PTZ00169 41..295 CDD:240302 65/275 (24%)
Mito_carr 128..218 CDD:278578 22/105 (21%)
Mito_carr 221..304 CDD:278578 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.