DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and MME1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:306 Identity:81/306 - (26%)
Similarity:131/306 - (42%) Gaps:35/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISAT--TGE---YKSSFDCLLKVFKNE 63
            |.||||.| ...:|.||:.||....:..|||.:|.|:|...|  .|:   ||...||..:.|:.|
  Fly     7 STEKKSNP-VKSFIAGGVGGMCNVLVGHPLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYE 70

  Fly    64 GILALYNGLSAGLMRQ--------ATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAF 120
            |....|.|:||.|:..        |.|...:. .:|.: |..|..:   |.:.|:   |.|||..
  Fly    71 GFRGFYRGISAPLVGVTPIYAVDFAVYAAGKR-LFQTD-DHIRLTY---PQIFAA---GALAGVC 127

  Fly   121 GAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMV 185
            .|:...|.:  .|:::...:........|.|.::...::.:..|:.:|:||....:.|...... 
  Fly   128 SALVTVPTD--RIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSPTGF- 189

  Fly   186 QLASYSQLKAAFSEYFSGLSLHIAAAMMSG-----LLTTIASMPLDMAKTRIQQQKTAEYK-GTM 244
            ...:|..|:....:..:...:...:.::||     :..|:| :|.|:.|:|:|......|| |..
  Fly   190 YFVTYEFLQELARKKSANGKISTTSTILSGGTAGIVFWTLA-VPFDVLKSRLQSAPEGTYKHGIR 253

  Fly   245 DVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLE---QLTKA 287
            .|...:...||..:|::|..|.|.|..|.|...|..:|   .|.||
  Fly   254 SVFRNLMATEGPKALFRGILPILLRAFPSTAAVFFGVELTNDLLKA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 73/292 (25%)
Mito_carr 19..90 CDD:278578 26/83 (31%)
Mito_carr 104..201 CDD:278578 18/96 (19%)
Mito_carr 207..284 CDD:278578 24/85 (28%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 32/98 (33%)
Mito_carr 111..205 CDD:278578 19/102 (19%)
Mito_carr 208..297 CDD:278578 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.