DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Ucp4B

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:311 Identity:93/311 - (29%)
Similarity:150/311 - (48%) Gaps:30/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAYSIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQ----ISATTGE---YKSSFDCLLK 58
            :.|.:..|..|...:|:....:......:..|.|:.|||||    |::..|:   |:......:.
  Fly    25 LEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMG 89

  Fly    59 VFKNEGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPP-------TVLASMGMGIL 116
            :.:.||:|.||.|:||.|.|.:.::..:|..|    |..|::...|.       :.|.|...|:|
  Fly    90 IVREEGLLKLYGGISAMLFRHSLFSGIKMLTY----DYMREKMIVPDEDGRPQLSFLGSCISGVL 150

  Fly   117 AGAFGAMFGNPAEVALIRM-MSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAM 180
            |||..::..||.|:..|:| |...|....|......||.|...|.:..||:.||||.:|...|:.
  Fly   151 AGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSA 215

  Fly   181 IVNMVQLASYSQLK----AAFSEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE-- 239
            :|.:..::.|...|    |.| :......:...|||.:|:...|.|:|.|:.|:||..|.|.|  
  Fly   216 LVTIGDVSCYDFCKRFLIAEF-DLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQG 279

  Fly   240 ----YKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
                |||::|.|.::.:.||..:::|||.||..|:||.:|..::..||:.:
  Fly   280 RGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 90/296 (30%)
Mito_carr 19..90 CDD:278578 21/77 (27%)
Mito_carr 104..201 CDD:278578 33/108 (31%)
Mito_carr 207..284 CDD:278578 31/82 (38%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 81/278 (29%)
Mito_carr 32..129 CDD:278578 27/100 (27%)
Mito_carr 138..233 CDD:278578 30/94 (32%)
Mito_carr 246..331 CDD:278578 32/85 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441670
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.