DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and colt

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:295 Identity:79/295 - (26%)
Similarity:131/295 - (44%) Gaps:13/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SIEKKSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQI--SATTGE---YKSSFDCLLKVFKNE 63
            |.|:|:.| ...::.||..|:.......|||.:|.|:|.  ....||   |:.:|||..|..|||
  Fly     8 STERKANP-VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNE 71

  Fly    64 GILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPA 128
            |:..||.|:||.|...|.........|.:.....::..:|..|.......|..:|.|..:...|.
  Fly    72 GVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPG 136

  Fly   129 EVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQL 193
            |  .|:::...:......|.|.|:::...::.|:.|:.:::||...|:.|.:..|.:....|..|
  Fly   137 E--RIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEAL 199

  Fly   194 K-AAFSEYFSG---LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYK-GTMDVLMKVSKN 253
            : .|.|:..:|   .:..|.|..::|:...|..||.|:.|:|:|......|| |...|...:...
  Fly   200 QDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVK 264

  Fly   254 EGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAY 288
            :|..:|::|.||.:.|..|.....|..:|...|.:
  Fly   265 DGPLALYRGVTPIMLRAFPANAACFFGIELANKFF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 74/280 (26%)
Mito_carr 19..90 CDD:278578 27/75 (36%)
Mito_carr 104..201 CDD:278578 21/97 (22%)
Mito_carr 207..284 CDD:278578 23/77 (30%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 30/95 (32%)
Mito_carr 112..202 CDD:395101 19/91 (21%)
Mito_carr 210..299 CDD:395101 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.