DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and sesB

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:286 Identity:65/286 - (22%)
Similarity:124/286 - (43%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQIS------ATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLM 77
            ||::..:....|.|::.||..:|:.      :...:||...||.:::.|.:|..:.:.|..|.::
  Fly    30 GGISAAVSKTAVAPIERVKLLLQVQHISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVI 94

  Fly    78 R----QATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSD 138
            |    ||.....:..:.|:.:....|..........::..|..|||....|..|.:.|..|:.:|
  Fly    95 RYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD 159

  Fly   139 NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFSG 203
            .  ....:|.:||:.|...:|.|.:|::.|::|...:|...:|........|...:....:. ..
  Fly   160 T--GKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDP-KN 221

  Fly   204 LSLHIAAAMMSGLLTTIA---SMPLDMAKTRIQQQ---KTAE--YKGTMDVLMKVSKNEGIASLW 260
            ..::|:.| ::.::||:|   |.|.|..:.|:..|   |..|  ||.|:.....::|.||..:.:
  Fly   222 TPIYISWA-IAQVVTTVAGIVSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFF 285

  Fly   261 KGFTPYLCRLGPHTVFAFIFLEQLTK 286
            ||....:.| |....|..:..:::.|
  Fly   286 KGAFSNILR-GTGGAFVLVLYDEIKK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 65/286 (23%)
Mito_carr 19..90 CDD:278578 18/80 (23%)
Mito_carr 104..201 CDD:278578 21/96 (22%)
Mito_carr 207..284 CDD:278578 23/84 (27%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 19/85 (22%)
PTZ00169 23..312 CDD:240302 65/286 (23%)
Mito_carr 124..220 CDD:278578 21/98 (21%)
Mito_carr 223..312 CDD:278578 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.