DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and SLC25A34

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_997231.1 Gene:SLC25A34 / 284723 HGNCID:27653 Length:304 Species:Homo sapiens


Alignment Length:301 Identity:85/301 - (28%)
Similarity:140/301 - (46%) Gaps:30/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSIPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTGE----------YKSSFDCLLKVFKN 62
            :::|..:..:.|..|..|......||::||||:|:.   ||          |......:..|.:.
Human     2 ETVPPAVDLVLGASACCLACVFTNPLEVVKTRLQLQ---GELQARGTYPRPYHGFIASVAAVARA 63

  Fly    63 EGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNP 127
            :|:..|..||:|||:.|......|...|.:...|...| ....||:|    |.:|||.||..|:|
Human    64 DGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQ-QPGGTVVA----GAVAGALGAFVGSP 123

  Fly   128 AEVALIRMMSDN--RLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASY 190
            |.:...::.:..  .:....:.|:..||.|...|.:.:|::.||:|....|.|.|:.:..|||::
Human   124 AYLIKTQLQAQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATF 188

  Fly   191 SQLKAAFSEY----FSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQ--KTAE----YKGTMD 245
            :..||...:.    .....:.:|..|:|.:...:...|.|:..||:..|  .||.    |.|..|
Human   189 ASAKAWVQKQQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTD 253

  Fly   246 VLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            .::|:.:.||..:|:||..|...||||||:.:.:|.::|.|
Human   254 CMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 84/293 (29%)
Mito_carr 19..90 CDD:278578 23/80 (29%)
Mito_carr 104..201 CDD:278578 29/102 (28%)
Mito_carr 207..284 CDD:278578 27/82 (33%)
SLC25A34NP_997231.1 Mito_carr 2..91 CDD:278578 24/91 (26%)
Solcar 1 4..97 25/95 (26%)
Solcar 2 101..194 29/97 (30%)
Mito_carr <119..197 CDD:278578 20/77 (26%)
Mito_carr 203..295 CDD:278578 29/92 (32%)
Solcar 3 204..295 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.