DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a10

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_038798.2 Gene:Slc25a10 / 27376 MGIID:1353497 Length:287 Species:Mus musculus


Alignment Length:274 Identity:98/274 - (35%)
Similarity:142/274 - (51%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82
            ||||.....|...||||:|..:|   |..|.|.....: |:|.:.:|.|||||||||.|.||.||
Mouse    12 GGLASCGAACCTHPLDLLKVHLQ---TQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTY 73

  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147
            :..|...|:...|...|....|......:.:|.::|..|...|.||::..:||.:|.:|||::||
Mouse    74 SLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPSQRR 138

  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLK--AAFSEYFS-GLSLHIA 209
            ||:..|:...|:.::|.:..|:.|......|..:|.:.||:.|.|.|  ...:.|.| .:..|..
Mouse   139 NYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFV 203

  Fly   210 AAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHT 274
            ::.::|...|....|||:.|||:...| .||:|.....|:.:| .|..:.:||..|...||.|||
Mouse   204 SSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAMETAK-LGPQAFFKGLFPAGIRLIPHT 266

  Fly   275 VFAFIFLEQLTKAY 288
            |..|:|||||.|.:
Mouse   267 VLTFMFLEQLRKHF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 97/271 (36%)
Mito_carr 19..90 CDD:278578 32/71 (45%)
Mito_carr 104..201 CDD:278578 29/98 (30%)
Mito_carr 207..284 CDD:278578 29/76 (38%)
Slc25a10NP_038798.2 Solcar 1 7..87 33/77 (43%)
Mito_carr 12..92 CDD:278578 35/82 (43%)
Mito_carr 94..189 CDD:278578 29/94 (31%)
Solcar 2 100..187 28/86 (33%)
Solcar 3 196..279 31/84 (37%)
Mito_carr 197..283 CDD:278578 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.