DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and SLC25A30

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:293 Identity:86/293 - (29%)
Similarity:138/293 - (47%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISATTGE-------YKSSFDCLLKVFKNEGILALYNGLS 73
            ::.||||.:...|...|:||.|||:||...|.:       |:.....|:::.:.||:.|||:|::
Human     9 FVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIA 73

  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPP---TVLASMGMGILAGAFGAMFGNPAEVALIRM 135
            ..::|||:|.|.::|.||    :.::.|...|   |:..::..|||:|...:...||.:|..|||
Human    74 PAMLRQASYGTIKIGTYQ----SLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRM 134

  Fly   136 MSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEY 200
            .:.:.....      |::..|:.|.:.||...||||...|..||.||..|:|..|...|...  .
Human   135 QAQSNTIQG------GMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHL--I 191

  Fly   201 FSGLS-----LHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT------AEYKGTMDVLMKVSKNE 254
            .|||.     .|..::...||...:||.|:|:.:||:..|:.      :.|.||:|.|::::..|
Human   192 LSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQLTVLE 256

  Fly   255 GIASLWK-----------------GFTPYLCRL 270
            ..::..|                 |||...|.|
Human   257 SFSTTAKPQKLISVDAISEEADTRGFTYLSCDL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 86/293 (29%)
Mito_carr 19..90 CDD:278578 28/77 (36%)
Mito_carr 104..201 CDD:278578 30/99 (30%)
Mito_carr 207..284 CDD:278578 22/87 (25%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 31/94 (33%)
Mito_carr 102..191 CDD:278578 29/96 (30%)
Mito_carr 199..>252 CDD:278578 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.