DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Ucp1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_033489.1 Gene:Ucp1 / 22227 MGIID:98894 Length:307 Species:Mus musculus


Alignment Length:281 Identity:88/281 - (31%)
Similarity:139/281 - (49%) Gaps:17/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NGGLAGMLGTCIVQPLDLVKTRMQI-----SATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLM 77
            :.|::..|...|..|||..|.|:||     :::|..||.....:..:.|.||:..||:||.||:.
Mouse    19 SAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQ 83

  Fly    78 RQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMG----MGILAGAFGAMFGNPAEVALIRMMSD 138
            ||.::.:.|:|.|    |:.::.|::.....||:|    .|::.|......|.|.||..:||.:.
Mouse    84 RQISFASLRIGLY----DSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRMQAQ 144

  Fly   139 NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSE---Y 200
            :.|...:.| |||..||:..|...|.:.|||||..|.:.|.:|:|..:|.:|..:|.|...   .
Mouse   145 SHLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNNKIL 208

  Fly   201 FSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTP 265
            ...:..|:.:|:::|..||:.:.|:|:.|||.......:|.......|.:...||..:.:|||..
Mouse   209 ADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMSMYTKEGPTAFFKGFVA 273

  Fly   266 YLCRLGPHTVFAFIFLEQLTK 286
            ...|||...|..|:..|||.|
Mouse   274 SFLRLGSWNVIMFVCFEQLKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 88/281 (31%)
Mito_carr 19..90 CDD:278578 26/75 (35%)
Mito_carr 104..201 CDD:278578 33/103 (32%)
Mito_carr 207..284 CDD:278578 23/76 (30%)
Ucp1NP_033489.1 Mito_carr 10..103 CDD:278578 28/87 (32%)
Solcar 1 11..102 28/86 (33%)
PTZ00169 21..297 CDD:240302 88/279 (32%)
Mito_carr 110..206 CDD:278578 33/96 (34%)
Solcar 2 111..201 32/90 (36%)
Solcar 3 210..295 26/85 (31%)
Mito_carr 215..300 CDD:278578 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.