DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc-25A10

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:277 Identity:103/277 - (37%)
Similarity:151/277 - (54%) Gaps:24/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVK----TRMQISATTGEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQ 79
            ||:||.:..|...||||:|    |:.|...|.|:..      ||::||:||||.|||:||.::||
 Worm    15 GGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLS------LKIYKNDGILAFYNGVSASVLRQ 73

  Fly    80 ATYTTARMGFYQMEIDAYRKQF--NAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLP 142
            .||:|.|.|.|    :..:||.  :.|........:...|||.|.|.|.|.::..:||.:|::||
 Worm    74 LTYSTTRFGIY----ETVKKQLPQDQPLPFYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLP 134

  Fly   143 PAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFSG---- 203
            ..:||||...|:..|||.::||.:.::.|......||:::.:.||:.|.|:|.....  ||    
 Worm   135 LEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLIS--SGVAED 197

  Fly   204 -LSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYL 267
             |..|.|:::.:..:.|:.:.|||:.|||:......|:||.:|..|..:| .|....:|||.|..
 Worm   198 NLQTHFASSISAASVATVMTQPLDVMKTRMMNAAPGEFKGILDCFMFTAK-LGPMGFFKGFIPAW 261

  Fly   268 CRLGPHTVFAFIFLEQL 284
            .||.||||..|||.|||
 Worm   262 ARLAPHTVLTFIFFEQL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 103/277 (37%)
Mito_carr 19..90 CDD:278578 34/74 (46%)
Mito_carr 104..201 CDD:278578 31/96 (32%)
Mito_carr 207..284 CDD:278578 30/76 (39%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 103/277 (37%)
Mito_carr 15..91 CDD:278578 36/85 (42%)
Mito_carr 95..193 CDD:278578 31/99 (31%)
Mito_carr 214..283 CDD:278578 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.