DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and ucp-4

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:290 Identity:84/290 - (28%)
Similarity:138/290 - (47%) Gaps:30/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AGMLGTCIVQPLDLVKTRMQISATT----GEYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATY 82
            |.::...:..|||:.|||:||:...    |..:.::|    :.:.||.:||:.|::..:.|...|
 Worm    33 AALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTYD----IIRREGAMALWTGVAPAITRHYIY 93

  Fly    83 TTARMGFY-QMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSD--NRLPPA 144
            |..|||.| |:.:..:.|:......:..||..|..:|.......:|.::..::|..:  .||...
 Worm    94 TGIRMGAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQ 158

  Fly   145 ERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF---SGLSL 206
            ..| |||..:.|..:.:.:|...||.|.||...||.::||..:|:|..:|....:.|   .....
 Worm   159 PLR-YTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFELKDNWLT 222

  Fly   207 HIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAE---------------YKGTMDVLMKVSKNEGI 256
            |..|:..:||...|.|:|.|:.|||:..|...|               |||.:|..:|:.||||.
 Worm   223 HAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGF 287

  Fly   257 ASLWKGFTPYLCRLGPHTVFAFIFLEQLTK 286
            .||:|||.|...|:.|.::..::..|::.|
 Worm   288 FSLYKGFLPSYIRMAPWSLTFWVSYEEIRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 84/290 (29%)
Mito_carr 19..90 CDD:278578 22/71 (31%)
Mito_carr 104..201 CDD:278578 26/98 (27%)
Mito_carr 207..284 CDD:278578 31/91 (34%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 83/288 (29%)
Mito_carr 22..111 CDD:278578 24/81 (30%)
Mito_carr 115..214 CDD:278578 26/99 (26%)
Mito_carr <240..318 CDD:278578 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.