DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and misc-1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_493694.2 Gene:misc-1 / 173414 WormBaseID:WBGene00015186 Length:306 Species:Caenorhabditis elegans


Alignment Length:303 Identity:167/303 - (55%)
Similarity:202/303 - (66%) Gaps:18/303 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTG--EYKSSFDCLLKVFKNEGILALYNGL 72
            :|..:.:..||.|||..|.:||||||||.|||:|.|||  ||:||...|..:.||||:.|:||||
 Worm     7 VPNVVKFAFGGTAGMGATLVVQPLDLVKNRMQLSGTTGKKEYRSSMHALTSIMKNEGVFAVYNGL 71

  Fly    73 SAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGM----GILAGAFGAMFGNPAEVALI 133
            ||||:|||||||.|:|.|...::.:.:: :.|    .|.||    |:.||..|:..|.|||:|||
 Worm    72 SAGLLRQATYTTTRLGTYAFLLERFTEK-DKP----LSFGMKAVLGMTAGGIGSFVGTPAEIALI 131

  Fly   134 RMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAF- 197
            ||..|.|||..:|||||||:||..||.|:|||:|||:||.|||.|||:||..|||:|||.|.|. 
 Worm   132 RMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALL 196

  Fly   198 --SEYFSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKT----AEYKGTMDVLMKVSKNEGI 256
              .:...|:..|..|:|:|||.|||||||:|:||||||..|.    .|||...||..||.|||||
 Worm   197 ASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGI 261

  Fly   257 ASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIVLGDDSES 299
            .:||||||||..|||||||..||.|||:..||...||..|..|
 Worm   262 FALWKGFTPYYMRLGPHTVLTFIILEQMNAAYFQYVLKRDVTS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 160/283 (57%)
Mito_carr 19..90 CDD:278578 48/72 (67%)
Mito_carr 104..201 CDD:278578 57/103 (55%)
Mito_carr 207..284 CDD:278578 52/80 (65%)
misc-1NP_493694.2 Mito_carr 7..99 CDD:278578 50/91 (55%)
Mito_carr 101..196 CDD:278578 57/98 (58%)
Mito_carr 202..296 CDD:278578 56/93 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164163
Domainoid 1 1.000 118 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S777
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0004406
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101430
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2168
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.710

Return to query results.
Submit another query.