DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and Slc25a10

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:274 Identity:97/274 - (35%)
Similarity:143/274 - (52%) Gaps:9/274 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82
            ||||.....|...||||:|..:|   |..|.|.....: |:|.:.:|.|||||||||.|.||.||
  Rat    12 GGLASCGAACCTHPLDLLKVHLQ---TQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTY 73

  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147
            :..|...|:...|...|....|....:.:.:|.::|..|...|.||::..:||.:|.:||.::||
  Rat    74 SLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPLSQRR 138

  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLK--AAFSEYFS-GLSLHIA 209
            ||:..|:...|:.::||:..|:.|......|..:|.:.||:.|.|.|  ...:.|.| .:..|..
  Rat   139 NYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFL 203

  Fly   210 AAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHT 274
            ::.::|...|....|||:.|||:...| .||:|.....::.:| .|..:.:||..|...||.|||
  Rat   204 SSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAK-LGPQAFFKGLVPAGVRLVPHT 266

  Fly   275 VFAFIFLEQLTKAY 288
            |..|:|||||.|.:
  Rat   267 VLTFMFLEQLRKHF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 96/271 (35%)
Mito_carr 19..90 CDD:278578 32/71 (45%)
Mito_carr 104..201 CDD:278578 29/98 (30%)
Mito_carr 207..284 CDD:278578 28/76 (37%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 35/82 (43%)
Mito_carr 94..189 CDD:395101 29/94 (31%)
Mito_carr 197..283 CDD:395101 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.