DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and SLC25A10

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:170 Identity:61/170 - (35%)
Similarity:88/170 - (51%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82
            ||||.....|...||||:|..:|   |..|.|.....: |:|.:.:||||||:||||.|.||.||
Human    13 GGLASCGAACCTHPLDLLKVHLQ---TQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTY 74

  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147
            :..|...|:...|...|....|......:.:|.::|..|...|.||::..:||.:|.:||..:||
Human    75 SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRR 139

  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQL 187
            ||...|:...|:.::||:..|:.|......|..:|.:.||
Human   140 NYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 61/170 (36%)
Mito_carr 19..90 CDD:278578 32/71 (45%)
Mito_carr 104..201 CDD:278578 26/84 (31%)
Mito_carr 207..284 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 35/82 (43%)
Mito_carr 95..179 CDD:278578 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.