DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and slc25a10a

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:slc25a10a / 100332610 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio


Alignment Length:274 Identity:95/274 - (34%)
Similarity:137/274 - (50%) Gaps:17/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GGLAGMLGTCIVQPLDLVKTRMQISATTGEYKSSFDCL-LKVFKNEGILALYNGLSAGLMRQATY 82
            ||:|.....|...||||:|..:|   |..|.|.....: ::|.:::|:.||||||||.|.||.:|
Zfish    12 GGIASCAAACCTHPLDLIKVHLQ---TQQEVKMRMTGMAVQVVRSDGVFALYNGLSASLCRQMSY 73

  Fly    83 TTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERR 147
            :..|...|:...|....|...|......:.:....|..|...|.||::..:||.:|.:|||..||
Zfish    74 SMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFIGTPADMVNVRMQNDMKLPPVLRR 138

  Fly   148 NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFSGLSL------ 206
            ||...|:..:|::|:||:..|:.|......|..:|.:.||:.|.|.|    :...|..|      
Zfish   139 NYAHALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAK----QLVLGTGLMTDNIF 199

  Fly   207 -HIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRL 270
             |..|:.::|...|:...|:|:.|||:...| .||:|.:..|....| .|..:.:||..|...||
Zfish   200 THFVASFIAGGCATVLCQPMDVVKTRLMNSK-GEYRGLIHCLSDTGK-LGPKAFYKGLVPAGIRL 262

  Fly   271 GPHTVFAFIFLEQL 284
            .||||..|||||||
Zfish   263 IPHTVLTFIFLEQL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 95/274 (35%)
Mito_carr 19..90 CDD:278578 28/71 (39%)
Mito_carr 104..201 CDD:278578 30/96 (31%)
Mito_carr 207..284 CDD:278578 30/76 (39%)
slc25a10aXP_002661286.1 Mito_carr 12..86 CDD:278578 29/76 (38%)
Mito_carr 94..190 CDD:278578 30/99 (30%)
Mito_carr 195..281 CDD:278578 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.