DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7514 and ucp1

DIOPT Version :9

Sequence 1:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:287 Identity:97/287 - (33%)
Similarity:132/287 - (45%) Gaps:21/287 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQISA-TTG-------EYKSSFDCLLKVFKNEGILALYNGL 72
            :|..|.|..:......|||..|.|:||.. |||       .||..|..:..:.|.||..:|||||
 Frog    17 FIAAGTAACIADLFTFPLDTAKVRLQIQGETTGSGAANGIRYKGVFGTISTIVKTEGPKSLYNGL 81

  Fly    73 SAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILA----GAFGAMFGNPAEVALI 133
            .|||.||.::.:.|:|.|...     |.|.......|.:|..|||    ||.......|.:|..:
 Frog    82 VAGLQRQMSFASIRIGLYDTV-----KLFYTNGKEKAGIGSRILAGCTTGALAVTVAQPTDVVKV 141

  Fly   134 RMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFS 198
            |..:...|...:|| |.|.::|:..|.|.|||..||||..|.|.|..|||..:|.:|..:|....
 Frog   142 RFQAQANLQGVKRR-YNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTELVTYDVIKENLL 205

  Fly   199 EY---FSGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGIASLW 260
            .|   ...|..|..:|..:|..||:.:.|:|:.|||.......:||..::....:...||..:.:
 Frog   206 HYKLMTDNLPCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQYKSALNCAWTMITKEGPTAFY 270

  Fly   261 KGFTPYLCRLGPHTVFAFIFLEQLTKA 287
            |||.|...|||...|..|:..|||.:|
 Frog   271 KGFVPSFLRLGSWNVVMFVSYEQLKRA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 96/285 (34%)
Mito_carr 19..90 CDD:278578 30/78 (38%)
Mito_carr 104..201 CDD:278578 35/103 (34%)
Mito_carr 207..284 CDD:278578 24/76 (32%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 34/97 (35%)
PTZ00169 14..299 CDD:240302 97/287 (34%)
Mito_carr 111..208 CDD:278578 34/97 (35%)
Mito_carr 211..302 CDD:278578 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.