DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KRT9 and LamC

DIOPT Version :9

Sequence 1:NP_000217.2 Gene:KRT9 / 3857 HGNCID:6447 Length:623 Species:Homo sapiens
Sequence 2:NP_001260974.1 Gene:LamC / 36615 FlyBaseID:FBgn0010397 Length:640 Species:Drosophila melanogaster


Alignment Length:413 Identity:108/413 - (26%)
Similarity:183/413 - (44%) Gaps:62/413 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   153 EKSTMQELNSRLASYLDKVQALEEANNDLE---NKIQDW-----------YDK------------ 191
            ||..:|.||.|||.|:|:::.||..|:.|.   |..||.           |:|            
  Fly    46 EKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDET 110

Human   192 -KGPAAIQKNYSPYYNTIDDLKDQI----VDLTVGNNKTLL------DIDNT-RMTLDDFRIKFE 244
             |..|.::.:....:...||||.::    .:.||..|...|      :::.. ..:|.| |.|||
  Fly   111 AKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLAD-RKKFE 174

Human   245 ME--------QNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTG 301
            .:        :.||:.:|    .||:.|:..|:.:.|||.|.::|:|||....:.|.:|:::...
  Fly   175 DQAKELALENERLRRQLD----DLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRS 235

Human   302 QNSGDVNVEINVAPGK-------DLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSS 359
            :.    .:||:...|:       .|.::|.::|.:||..:..||::||..|:.:|..::...:.:
  Fly   236 RR----QIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRA 296

Human   360 GQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQIT 424
            .|....:.:||..:|..:..|..:||:.....|.|...:.:.:|....:.|...:.|::|||::.
  Fly   297 AQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQ 361

Human   425 DVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGS 489
            .:|.|:..|.|||..|:.||:.|:.||..|..||.|.:........|:........|.||:...|
  Fly   362 RMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSGISSNGSHLTAS 426

Human   490 RGGSGGSYGGGGSGGGYGGGSGS 512
            .....|.....|......|.|||
  Fly   427 ASSRSGRVTPSGRRSATPGISGS 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KRT9NP_000217.2 Head 1..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Filament 152..464 CDD:365827 97/363 (27%)
Coil 1A 153..188 16/37 (43%)
Linker 1 189..207 4/30 (13%)
Coil 1B 208..299 31/109 (28%)
Linker 12 300..322 4/28 (14%)
Coil 2 323..461 40/137 (29%)
Tail 462..623 11/51 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..496 5/33 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..623
LamCNP_001260974.1 Filament 45..401 CDD:278467 97/363 (27%)
ATP-synt_B <67..>142 CDD:304375 15/74 (20%)
MreC <178..>224 CDD:302802 15/49 (31%)
LTD 473..574 CDD:279300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.