DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDAC9

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_848512.1 Gene:HDAC9 / 9734 HGNCID:14065 Length:1069 Species:Homo sapiens


Alignment Length:458 Identity:122/458 - (26%)
Similarity:193/458 - (42%) Gaps:121/458 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQ 90
            ||....||:...:.|...||..|.|..:..||:.:|:...||:.:    ..:...|..:..|...
Human   657 HPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHH----SLLYGTNPLDGQKLDP 717

  Fly    91 RFNVGEDCPVFDGLYEFCQLSAGG--------------------SVAAAVKLNKQASEICINWGG 135
            |..:|:|...|     |..|..||                    :|...::|   ||::.   .|
Human   718 RILLGDDSQKF-----FSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIEL---ASKVA---SG 771

  Fly   136 GL-----------HHAKKSEASGFCYVNDIVLGILELLKYHQ------RVLYIDIDVHHGDGVEE 183
            .|           |||::|.|.|||:.|.:.:    ..||.:      ::|.:|:|||||:|.::
Human   772 ELKNGFAVVRPPGHHAEESTAMGFCFFNSVAI----TAKYLRDQLNISKILIVDLDVHHGNGTQQ 832

  Fly   184 AFYTTDRVMTVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMD----DDAYESIFVPI 242
            |||....::.:|.|:|  |.:|||:|...::|.|.|:.|.:||....|:|    |..|...|..|
Human   833 AFYADPSILYISLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTI 897

  Fly   243 ISKVMETFQPAAVVLQCGADSLTGDR--LGCFNLTVK--GH----------GKCVEFVKKYNLPF 293
            :..|.:.|.|..|::..|.|:|.|..  ||.:.:|.|  ||          |:.|..::      
Human   898 VKPVAKEFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALE------ 956

  Fly   294 LMVGGGGYTIRNVSRCWTYETSV-ALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYL 357
                 ||:.:..:  |...|..| ||   :.|||      |....|. ||.||    |.|....|
Human   957 -----GGHDLTAI--CDASEACVNAL---LGNEL------EPLAEDI-LHQSP----NMNAVISL 1000

  Fly   358 EK---IKNRLFENLRM--LPHA---PGVQIQAIPE--DAINDESDDEDKVDKDDRLPQSDKDKRI 412
            :|   |:::.::::||  :|..   .|.|:|...|  .|:...:.|.::       |.:.:|.|.
Human  1001 QKIIEIQSKYWKSVRMVAVPRGCALAGAQLQEETETVSALASLTVDVEQ-------PFAQEDSRT 1058

  Fly   413 VPE 415
            ..|
Human  1059 AGE 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 111/408 (27%)
HDAC9NP_848512.1 Interaction with CTBP1. /evidence=ECO:0000250 23..27
ClassIIa_HDAC9_Gln-rich-N 38..127 CDD:197399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..142
Interaction with MEF2. /evidence=ECO:0000250 139..157
Interaction with MAPK10. /evidence=ECO:0000250 178..346
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..252
Interaction with ETV6. /evidence=ECO:0000269|PubMed:12590135 221..264
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..307
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..539
HDAC_classIIa 634..1011 CDD:212544 109/399 (27%)
Histone deacetylase 634..981 98/364 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.