DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDAC3

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001341968.1 Gene:HDAC3 / 8841 HGNCID:4854 Length:434 Species:Homo sapiens


Alignment Length:445 Identity:247/445 - (55%)
Similarity:333/445 - (74%) Gaps:24/445 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYV 71
            |.|.|:||.|:||::||.||||||||:.:||:|:|:||||:||.:::|::|:..:|.:|||::|:
Human     3 KTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYI 67

  Fly    72 RFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGG 136
            .||:.:.|.||..:.|.:..||||:|||||.||:|||....|.|:..|.:||.:..:|.|||.||
Human    68 DFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGG 132

  Fly   137 LHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE 201
            ||||||.||||||||||||:|||||||||.||||||||:||||||:||||.|||||||||||||.
Human   133 LHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGN 197

  Fly   202 Y-FPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLT 265
            | ||||||:.::||..|:||.:|:|||||:||.:|:.:|.|:|::|::.:||..:|||||||||.
Human   198 YFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLG 262

  Fly   266 GDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYND 330
            .||||||||:::|||:|||:||.:|:|.|::||||||:|||:||||||||:.:...|:.||||::
Human   263 CDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSE 327

  Fly   331 YFEYFGPDFKLHISPS-NMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDE 394
            |||||.|||.||...| .:.|||:.:||::|:..:||||:||.|||.|||..:|.|.:.      
Human   328 YFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLT------ 386

  Fly   395 DKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRD----NRSYKGQRKRPRLD 445
                 .||..::|.::| .||..||.|      |.||    :....|:.||.:::
Human   387 -----YDRTDEADAEER-GPEENYSRS------GSRDFSLLSIGLLGRFKREKVN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 223/366 (61%)
HDAC3NP_001341968.1 HDAC3 3..383 CDD:212529 231/379 (61%)
Histone deacetylase 3..316 196/312 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D267420at33208
OrthoFinder 1 1.000 - - FOG0000617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100248
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.