DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDA1

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_014377.1 Gene:HDA1 / 855710 SGDID:S000004966 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:99/360 - (27%)
Similarity:172/360 - (47%) Gaps:51/360 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKRVCY-----YYDSDIGNYY-YGQGHPMKPHRIRMTHNLLLNYGLYR---------------KM 49
            |..:||     |:.....:|: |...||..|.||...:.:|...||..               |:
Yeast    57 KTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKI 121

  Fly    50 EIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGG 114
            .:   ..||::|:.:.|:.|::.|:.|....:..|..|:.::   |:.....:..|...:|..||
Yeast   122 PV---RAATSEEILEVHTKEHLEFIESTEKMSREELLKETEK---GDSVYFNNDSYASARLPCGG 180

  Fly   115 SVAA--AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYH----QRVLYIDI 173
            ::.|  ||...:..:.:.:....| |||:...|.|||..:::.:....:||.:    :|::.:|.
Yeast   181 AIEACKAVVEGRVKNSLAVVRPPG-HHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDW 244

  Fly   174 DVHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPGT--GDLRDIGAGKGKYYAVNI--PLRDGMDD 232
            |:|||:|.:::||..|:|:.||.|::  |:|:|||  |.....|.|||:.:..||  |: .|:.|
Yeast   245 DIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV-GGVGD 308

  Fly   233 DAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVK---KYNLPFL 294
            ..|...|..::..:...|:|..|::..|.|:..||.:|..::|...:|.....:|   :.||  .
Yeast   309 AEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNL--C 371

  Fly   295 MVGGGGYTIRNVSRCWTYETSVA--LAVEIANELP 327
            :|..|||.:..::|.   ..|||  |..|..:|||
Yeast   372 VVLEGGYNLDAIARS---ALSVAKVLIGEPPDELP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 99/360 (28%)
HDA1NP_014377.1 HDAC_Clr3 81..403 CDD:212542 91/334 (27%)
Arb2 457..698 CDD:401634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.