DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac5

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_038942911.1 Gene:Hdac5 / 84580 RGDID:619980 Length:1120 Species:Rattus norvegicus


Alignment Length:342 Identity:94/342 - (27%)
Similarity:148/342 - (43%) Gaps:63/342 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQ 90
            ||....||:...:.|...||..|.|..|..|||.||:...|| ||...|....|.|..:.:.:..
  Rat   714 HPEHAGRIQSIWSRLQETGLLSKCERIRGRKATLDEIQTVHS-EYHTLLYGTSPLNRQKLDSKKL 777

  Fly    91 RFNVGEDCPVFDGLYEFCQLSAGG-SVAAAVKLNKQASEICINWGGGL----------------- 137
               :|   |:...:|  ..|..|| .|.:....|:..|...:....|.                 
  Rat   778 ---LG---PISQKMY--AMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGF 834

  Fly   138 -------HHAKKSEASGFCYVNDIVLGILELLKYH---QRVLYIDIDVHHGDGVEEAFYTTDRVM 192
                   |||::|.|.|||:.|.:.: ..:||:..   .:||.:|.|:|||:|.::|||....|:
  Rat   835 AIIRPPGHHAEESTAMGFCFFNSVAI-TAKLLQQKLSVGKVLIVDWDIHHGNGTQQAFYDDPSVL 898

  Fly   193 TVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMD----DDAYESIFVPIISKVMETFQ 251
            .:|.|:|  |.:|||:|...::|.|.|..|.||:....|:|    |..|.:.|..::..:...|.
  Rat   899 YISLHRYDNGNFFPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFS 963

  Fly   252 PAAVVLQCGADSLTG--DRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGG-------GGYTIRNVS 307
            |..|::..|.|::.|  ..||.:::|.:..|.....:      ..:.||       ||:.:..: 
  Rat   964 PDVVLVSAGFDAVEGHLSPLGGYSVTARCFGHLTRQL------MTLAGGRVVLALEGGHDLTAI- 1021

  Fly   308 RCWTYETSVA--LAVEI 322
             |...|..|:  |:||:
  Rat  1022 -CDASEACVSALLSVEL 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 94/342 (27%)
Hdac5XP_038942911.1 ClassIIa_HDAC_Gln-rich-N 87..174 CDD:421006
Arginase_HDAC 689..1105 CDD:418394 94/342 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.