DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDA05

DIOPT Version :10

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_001190583.1 Gene:HDA05 / 836227 AraportID:AT5G61060 Length:664 Species:Arabidopsis thaliana


Alignment Length:53 Identity:14/53 - (26%)
Similarity:22/53 - (41%) Gaps:12/53 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 KPDTSFVHHDVEEAVKV---------KMLNYHS--ERLAIAFGLIFVPSGQPI 668
            |..|.|||.|..:.:.:         |.|..||  :|..:. |.:.:.|..|:
plant    33 KQATQFVHKDSADLLPLDQLRRLGTSKDLQPHSVIQRRLMG-GSLSIESDNPV 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:450134
HDA05NP_001190583.1 Arginase_HDAC 31..388 CDD:450134 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.