DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDA2

DIOPT Version :10

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_568480.2 Gene:HDA2 / 832673 AraportID:AT5G26040 Length:387 Species:Arabidopsis thaliana


Alignment Length:105 Identity:22/105 - (20%)
Similarity:44/105 - (41%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 SKGKWDSVAQLR-RGMREKNVKKEPGQ----SWIK-WKGKLHSFSADDESSPYLD-QIYAKLEEL 617
            |:|:.....:.| :.:.:...|::..|    ..:| |: :||.|.|:|.....:. |:|:.    
plant    67 SRGRQSKTCKFRMKRISDSKHKQQVDQLELYGTVKDWR-ELHFFPAEDSFFKVIKRQLYSG---- 126

  Fly   618 NNKIIDNGYKPDTSFVHHDVEEAVKVKMLNYHSERLAIAF 657
                ||..|:.:.:.:...:...:.|   |..|:.|...|
plant   127 ----IDMAYEQELTMIFGSINLRINV---NEFSQNLPCTF 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:450134
HDA2NP_568480.2 HDAC_classIV 93..376 CDD:212519 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.