DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hda17

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_190035.1 Gene:hda17 / 823574 AraportID:AT3G44490 Length:158 Species:Arabidopsis thaliana


Alignment Length:155 Identity:71/155 - (45%)
Similarity:102/155 - (65%) Gaps:1/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 FNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFG 336
            |::...||.:||:||||:|||.|:.||||||..||:||||.||.:.|..|:.||:..|||.:||.
plant     3 FSMLFTGHAECVKFVKKFNLPLLVTGGGGYTKENVARCWTVETGILLDTELPNEISENDYIKYFA 67

  Fly   337 PDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDD 401
            |||.|.|...::.|.||..|:..||.::.||||.:.|||.||:|.:|.|....:. |||:.:.|.
plant    68 PDFSLKIPGGHIENLNTKSYISSIKVQILENLRYIQHAPSVQMQEVPPDFYIPDF-DEDEQNPDV 131

  Fly   402 RLPQSDKDKRIVPENEYSDSEDEGE 426
            |:.|..:||:|..::||.|.:::.:
plant   132 RVDQRSRDKQIQRDDEYFDGDNDND 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 51/99 (52%)
hda17NP_190035.1 Arginase_HDAC <3..116 CDD:302587 58/112 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.