DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac8

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_006528338.1 Gene:Hdac8 / 70315 MGIID:1917565 Length:386 Species:Mus musculus


Alignment Length:346 Identity:148/346 - (42%)
Similarity:232/346 - (67%) Gaps:5/346 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNV 94
            |.|..|.|:|:..|.|:::|.|.:|..|:.:||..||:|.|::.|:.:..:...::...:: :.:
Mouse    35 PKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIE-YGL 98

  Fly    95 GEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGIL 159
            |.|||..:|::::.....||::.||..|.....::.|||.||.|||||.|||||||:||.|||||
Mouse    99 GYDCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEASGFCYLNDAVLGIL 163

  Fly   160 ELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPGTGDLRDIGAGKGKYYAVN 223
            .|.:...|:||:|:|:|||||||:||..|.:|||||.||:.. :||||||:.|:|.|||:||:||
Mouse   164 RLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDMSDVGLGKGRYYSVN 228

  Fly   224 IPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKK 288
            :|::||:.|:.|..|...::.:|.:.|.|.|||||.|||::.||.:..||:|..|.|||:::|.:
Mouse   229 VPIQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQ 293

  Fly   289 YNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNT 353
            :.|..|::|||||.:.|.:|||||.|.|.|...:::|:|.:::|..:|||:.|.|:||...::|.
Mouse   294 WQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNE 358

  Fly   354 SEYLEKIKNRLFENLRMLPHA 374
            ...:::|.|.:   ..::||:
Mouse   359 PHRIQQILNYI---KAVVPHS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 146/342 (43%)
Hdac8XP_006528338.1 HDAC8 16..370 CDD:212524 146/338 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54588
OrthoDB 1 1.010 - - D732770at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.