DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac9

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_017449847.1 Gene:Hdac9 / 687001 RGDID:1310748 Length:1094 Species:Rattus norvegicus


Alignment Length:440 Identity:114/440 - (25%)
Similarity:185/440 - (42%) Gaps:99/440 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQ 90
            ||....||:...:.|...||..|.|..:..||:.:|:...|| |:...|....|   .:..|...
  Rat   682 HPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHS-EHHSLLYGTSP---LDGQKLDP 742

  Fly    91 RFNVGEDCPVFDGLYEFCQLSAGG--------------------SVAAAVKLNKQASEICINWGG 135
            |..:|:|...|     |..|..||                    :|...::|   ||::.   .|
  Rat   743 RTLLGDDSRKF-----FSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIEL---ASKVA---SG 796

  Fly   136 GL-----------HHAKKSEASGFCYVNDIVLGILELLKYHQ------RVLYIDIDVHHGDGVEE 183
            .|           |||::|.|.|||:.|.:.:    ..||.:      ::|.:|:|||||:|.::
  Rat   797 ELKNGFAVVRPPGHHAEESAAMGFCFFNSVAI----TAKYLRDQLNISKILIVDLDVHHGNGTQQ 857

  Fly   184 AFYTTDRVMTVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMD----DDAYESIFVPI 242
            |||....::.:|.|:|  |.:|||:|...::|.|.|:.|.|||....|:|    |..|...|..:
  Rat   858 AFYADPSILYISLHRYDEGNFFPGSGAPNEVGVGLGEGYNVNIAWTGGLDPPMGDVEYLEAFRTV 922

  Fly   243 ISKVMETFQPAAVVLQCGADSLTGDR--LGCFNLTVKGHGKCV-EFVKKYNLPFLMVGGGGYTIR 304
            :..|...|.|..|::..|.|:|.|..  ||.:.:|.|..|... :.:...|....:...||:.:.
  Rat   923 VMPVAREFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLANGRVALALEGGHDLT 987

  Fly   305 NVSRCWTYETSVALAVEIANELPYNDYFEYFGP----DFKLHISPSNMTNQNTSEYLEK---IKN 362
            .:  |...|..:       |.|..|:      |    :..||.|    .|.|.:..|:|   |::
  Rat   988 AI--CDASEACI-------NALLGNE------PGSLEEDVLHQS----VNTNAAASLQKTIEIQS 1033

  Fly   363 RLFENLRMLPHAPGVQIQAIPEDAINDESDDED-----KVDKDDRLPQSD 407
            :.:::::|:..|.|.   |:|...:.:|::...     .||.:....|.|
  Rat  1034 KYWKSIKMVAVARGC---ALPASQLQEETETVSALASLTVDVEQPFAQED 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 105/398 (26%)
Hdac9XP_017449847.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.