DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and Hdac7

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_036015418.1 Gene:Hdac7 / 56233 MGIID:1891835 Length:977 Species:Mus musculus


Alignment Length:358 Identity:91/358 - (25%)
Similarity:145/358 - (40%) Gaps:80/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YDSDIGNYYYGQG----HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRF 73
            |||.:..:....|    ||....||:...:.|...||..:.|..|..||:.:|:...||:.:|..
Mouse   550 YDSVMLKHQCSCGDNSKHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLL 614

  Fly    74 -----LRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGG-SVAAAVKLNKQASEICIN 132
                 |..::.||........||              .|..|..|| .|......|:..|.....
Mouse   615 YGTNPLSRLKLDNGKLTGLLAQR--------------TFVMLPCGGVGVDTDTIWNELHSSNAAR 665

  Fly   133 WGGGL------------------------HHAKKSEASGFCYVNDIVLGILELLKYHQ--RVLYI 171
            |..|.                        |||..|.|.|||:.|.:.:...:|.::.:  ::|.:
Mouse   666 WAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQHGKASKILIV 730

  Fly   172 DIDVHHGDGVEEAFYTTDRVMTVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMD--- 231
            |.|||||:|.::.||....|:.:|.|::  |.:|||:|.:.::|.|.|:.:.||:....|:|   
Mouse   731 DWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGTGSGEGFNVNVAWAGGLDPPM 795

  Fly   232 -DDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGD--RLGCFNLTVKGHGKCVEFVKKYNLPF 293
             |..|.:.|..::..:...|.|..|::..|.|:..|.  .||.::::.|..|        |....
Mouse   796 GDPEYLAAFRIVVMPIAREFAPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFG--------YMTQQ 852

  Fly   294 LMVGGGGYTIRNVSRCWTYETSVALAVEIANEL 326
            ||...||              :|.||:|..::|
Mouse   853 LMNLAGG--------------AVVLALEGGHDL 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 91/358 (25%)
Hdac7XP_036015418.1 PHA03247 <124..527 CDD:223021
HDAC7 546..921 CDD:212532 91/358 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.