DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and HDAC8

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:XP_011529288.3 Gene:HDAC8 / 55869 HGNCID:13315 Length:403 Species:Homo sapiens


Alignment Length:338 Identity:145/338 - (42%)
Similarity:228/338 - (67%) Gaps:2/338 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNV 94
            |.|..|.|:|:..|.|:::|.|.:|..|:.:||..||:|.|::.|:.:..:...::...:: :.:
Human    35 PKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIE-YGL 98

  Fly    95 GEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGIL 159
            |.|||..:|::::.....|.::.||..|.....::.|||.||.|||||.|||||||:||.|||||
Human    99 GYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGIL 163

  Fly   160 ELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPGTGDLRDIGAGKGKYYAVN 223
            .|.:..:|:||:|:|:|||||||:||..|.:|||||.||:.. :||||||:.|:|.|||:||:||
Human   164 RLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVN 228

  Fly   224 IPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKK 288
            :|::||:.|:.|..|...::.:|.:.|.|.|||||.|||::.||.:..||:|..|.|||::::.:
Human   229 VPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQ 293

  Fly   289 YNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNT 353
            :.|..|::|||||.:.|.:|||||.|.|.|...:::|:|.:::|..:|||:.|.|:||...::|.
Human   294 WQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNE 358

  Fly   354 SEYLEKIKNRLFE 366
            ...:::|.|.:.|
Human   359 PHRIQQILNYIKE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 145/338 (43%)
HDAC8XP_011529288.3 HDAC8 16..371 CDD:212524 144/336 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54588
OrthoDB 1 1.010 - - D732770at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.