DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC1 and hdac8

DIOPT Version :9

Sequence 1:NP_647918.2 Gene:HDAC1 / 38565 FlyBaseID:FBgn0015805 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_998596.1 Gene:hdac8 / 406740 ZFINID:ZDB-GENE-040426-2772 Length:378 Species:Danio rerio


Alignment Length:341 Identity:154/341 - (45%)
Similarity:227/341 - (66%) Gaps:2/341 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNV 94
            |:|..|.|:|:..|||.:.|.:.:||.|:.:||..||:|.|::.|..|..|..:: :.|...|.:
Zfish    36 PNRASMVHSLIEAYGLLKYMRVVKPHVASIEEMAVFHTDSYLQHLHKISQDGDND-DPQSADFGL 99

  Fly    95 GEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGIL 159
            |.||||.:|::::.....|.::.||..|.....::.|||.||.|||||.||||.|||||.|||||
Zfish   100 GYDCPVVEGIFDYAAAVGGATLTAAQNLLDGKCDVAINWAGGWHHAKKDEASGSCYVNDAVLGIL 164

  Fly   160 ELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGE-YFPGTGDLRDIGAGKGKYYAVN 223
            :|.:.:.||||:|:|:|||||||:||..|.:|||||.||:.. :||||||:.|.|.|||::||||
Zfish   165 KLREKYDRVLYVDVDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVTDTGLGKGRWYAVN 229

  Fly   224 IPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKK 288
            :|..||:.||.|...|..::.:|...|.|.|||:|.|||::.||.:..||:|..|..||:.::..
Zfish   230 VPFEDGVRDDRYCQTFTSVMQEVKALFNPEAVVMQLGADTMAGDPMCSFNMTPVGVAKCLTYILG 294

  Fly   289 YNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNT 353
            :.||.|::|||||.:.|.:|||||.|...|...:::|:|.:::|..:|||:.|.||||...::|.
Zfish   295 WELPTLLLGGGGYNLANTARCWTYLTGTVLGQTLSSEIPDHEFFTEYGPDYSLEISPSCRPDRNE 359

  Fly   354 SEYLEKIKNRLFENLR 369
            |::||::.:.:..||:
Zfish   360 SQHLERVISTIKGNLK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC1NP_647918.2 Arginase_HDAC 5..372 CDD:388375 154/341 (45%)
hdac8NP_998596.1 Histone deacetylase. /evidence=ECO:0000250 15..325 136/289 (47%)
HDAC8 17..378 CDD:212524 154/341 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54588
OrthoDB 1 1.010 - - D732770at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.